<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27271

Description Cyclin dependent kinase 8
SequenceMDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWKIGPELTSVATFLYKAFNIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSTTSQQPPQYSHQTHRY
Length464
PositionKinase
OrganismEquus caballus (Horse)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Perissodactyla> Equidae> Equus.
Aromaticity0.09
Grand average of hydropathy-0.685
Instability index39.96
Isoelectric point8.72
Molecular weight53225.02
Publications
PubMed=19892987

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleolus	GO:0005730	IEA:Ensembl
nucleus	GO:0005634	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central

GO - Biological Process
protein phosphorylation	GO:0006468	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27271
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.49|      26|      85|     226|     252|       2
---------------------------------------------------------------------------
  226-  252 (45.25/31.60)	ELLTSEPIFHCRQEDiKTSNPYH.HDQL
  314-  340 (43.24/25.62)	KLLTMDPIKRITSEQ.AMQDPYFlEDPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.09|      15|      36|     151|     165|       4
---------------------------------------------------------------------------
  151-  165 (27.29/22.55)	DLKPANILVMGEGPE
  189-  203 (28.79/24.24)	DLDPVVVTFWKIGPE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27271 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSTTSQQPPQYSHQTHRY
351
464










Molecular Recognition Features






MoRF SequenceStartStop




NANANA