<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27269

Description Mediator of RNA polymerase II transcription subunit 1
SequencePAESEKLTKMASLLERLHAKFNQNRPWSETIKLVRQVMEKRIVLSSGGHQHLVGCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDSSGQLCDVKVAHHGENPASCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLAKMALMYWKATNASPLDKILHGSVGYLTPRSGGHLMNLKYYASPYDLLEGKTAAPIVLHENNVPRSLGLNASVTIEGTSTMYKLPIAPLIMGSHPVDNKWTPSFSSVTSANSVDLPACFFLKFPRPIPVSRPFVQKLQSCTGERLTPAGRRLPRGRRVARETRPRAGFRGDRYHXALPGQQHCYFLNKDAPLPDGRSLQGTLVGKIAFQHPGRVPAVLGLIRHQVAYNTLIGSCVKRTILKEDSPGILQFEVCPLSDSCFSVSFQHPVNDSLVCVEL
Length455
PositionMiddle
OrganismOrnithorhynchus anatinus (Duckbill platypus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Monotremata> Ornithorhynchidae> Ornithorhynchus.
Aromaticity0.07
Grand average of hydropathy-0.248
Instability index52.10
Isoelectric point9.25
Molecular weight50275.46
Publications
PubMed=18464734

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
retinoic acid receptor binding	GO:0042974	IBA:GO_Central
thyroid hormone receptor binding	GO:0046966	IBA:GO_Central
transcription coregulator activity	GO:0003712	IBA:GO_Central
vitamin D receptor binding	GO:0042809	IBA:GO_Central
GO - Biological Process
cellular response to thyroid hormone stimulus	GO:0097067	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP27269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.04|      26|      32|     181|     211|       1
---------------------------------------------------------------------------
  181-  211 (42.60/42.44)	MALMYWkatnASPLDkILHGSVG...YL....TPRSGG
  214-  246 (38.44/24.17)	MNLKYY....ASPYD.LLEGKTAapiVLhennVPRSLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.26|      31|      98|      19|      54|       2
---------------------------------------------------------------------------
   19-   54 (41.39/51.83)	AKFNQNrPWSeTIKLVRQVMEKRIVLSSgghQHLVG
  120-  150 (57.88/44.62)	AHHGEN.PAS.CPELVQQLREKNFDEFS...KHLKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.12|      21|      28|     287|     309|       3
---------------------------------------------------------------------------
  287-  309 (34.67/26.09)	SANSVDL.PACffLKFPRPIPVSR
  317-  338 (33.45/18.08)	SCTGERLtPAG..RRLPRGRRVAR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP27269 with Med1 domain of Kingdom Metazoa

Unable to open file!