<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27255
Description |
Mediator complex subunit 22 |
Sequence | MAQQRVLPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRSLQDECDKKLISLRDEISIDLYELEEEYYSSSYSLCDTIDLPLCEAYWRQDLTSFSPDGLSAPLLVSPAESGTAPMQGTAPVLPHVNGPGSGPTEHA |
Length | 203 |
Position | Head |
Organism | Monodelphis domestica (Gray short-tailed opossum) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.515 |
Instability index | 61.05 |
Isoelectric point | 4.57 |
Molecular weight | 22796.29 |
Publications | PubMed=17495919
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27255
No repeats found
No repeats found
|