<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27253
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATAQQQGNAPNNLETQTQSSMPLPIMKYVSQYTDEAVKRGTAPKPPAPVRTSYEMFGQECHQDDAIIRPLETQGLSRLHPEVYDKRNELKKISVSILCSFLDLLDVLVKSGMSTARDEKIEDLNLLFIHMHHLINEYRPHQARETLKVMMALQKKNMIDVSETLCKNMDKASEILHQCSQELAAMKVKSSVIDQSNSMMEVDSGYRENSHNEEDTQDEKDIIMCSFVDGMKE |
Length | 233 |
Position | Middle |
Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.579 |
Instability index | 46.99 |
Isoelectric point | 5.31 |
Molecular weight | 26522.98 |
Publications | PubMed=12481130
PubMed=15114417
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP27253
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.75| 15| 124| 85| 103| 1
---------------------------------------------------------------------------
85- 103 (18.94/21.94) DKRNElKKIsvsILCSFLD
215- 229 (29.81/18.00) DTQDE.KDI...IMCSFVD
---------------------------------------------------------------------------
|