<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27250
Description |
Uncharacterized protein |
Sequence | MEDEIIRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPSTDKDSDEKKKEPAISSQNSPEAKEESSSSSNASNRKEETNASDSFIPSFPRAPSTSDSVRMKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQELRNTDMKYKNRVRSRIANLKDAKNPNLRKNVLCGNIPPDLFARLTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC |
Length | 301 |
Position | Unknown |
Organism | Monodelphis domestica (Gray short-tailed opossum) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.791 |
Instability index | 49.72 |
Isoelectric point | 8.50 |
Molecular weight | 33792.09 |
Publications | PubMed=17495919
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27250
No repeats found
|