<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27249
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | YLDADIPNSTDLTGSVNLILHYNLEHSFSKFCGKKMKEKLSNFLPDLPGMIDTPGAQDNSSLRSLIEKPPICGNSFTPLTGALLTGFRLHTGPLPEQCRLMHIQPPKKKNKKHKQSRTQEPAPPDVDLSHELQNKESKSLNPESLNRRTEHKAKRKSRHSPEHPGAGSSQNTSSSDFS |
Length | 178 |
Position | Head |
Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.937 |
Instability index | 61.42 |
Isoelectric point | 9.28 |
Molecular weight | 19787.09 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27249
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.85| 17| 18| 105| 121| 1
---------------------------------------------------------------------------
105- 121 (30.72/17.31) PPK...KKNKKHKQSRTQEP
123- 142 (25.13/12.95) PPDvdlSHELQNKESKSLNP
---------------------------------------------------------------------------
|