<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27244
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | SLDLLSSTIMATSSSSDKEKERTGGASGGPPAGLSTREKLLSVLEDLEVLSRELIENLAISRSQKLLQAGEENQIIELLIHRDGEFQELMKLALEQGKVHHEMQLLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIDKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSVNMLPPNHSNDFMLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 280 |
| Position | Middle |
| Organism | Monodelphis domestica (Gray short-tailed opossum) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.598 |
| Instability index | 52.16 |
| Isoelectric point | 4.90 |
| Molecular weight | 30720.07 |
| Publications | PubMed=17495919
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27244
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.10| 24| 24| 104| 127| 1
---------------------------------------------------------------------------
65- 96 (27.40/16.39) KLLQAGEEnqiielliHRDGEFQELMKLALEQ
104- 127 (36.31/23.91) QLLEKEVE........KRDSDIQQLQKQLKEA
129- 152 (30.39/18.91) QILATAVY........QAKEKLKSIDKARKGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.09| 11| 259| 9| 19| 2
---------------------------------------------------------------------------
9- 19 (20.02/10.73) IMAT...SSSSDKE
267- 280 (15.07/ 6.62) VMSTdssSSSSDSD
---------------------------------------------------------------------------
|