<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27243
| Description |
Mediator complex subunit 29 |
| Sequence | MAASQQQASAASSAAGVSGPGSAGGSGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLTQNTNIDNGQKSSDGPMQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
| Length | 200 |
| Position | Tail |
| Organism | Equus caballus (Horse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Perissodactyla> Equidae> Equus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.398 |
| Instability index | 65.26 |
| Isoelectric point | 5.86 |
| Molecular weight | 21052.59 |
| Publications | PubMed=19892987
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27243
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.79| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (37.73/14.14) GPGSAGGSGPQQQPQPPAQ
40- 58 (35.06/12.73) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|