<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27222
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | PFLRSPVCFQVGQNSMPMMSSPSPVQQAQTPQSMPPPPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPVNPNSVMSPASASQSEEQQYLEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAQVIAPRKRKLEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDRNLPSVPPLELSVPADYPDQSPLWIDKQWQYGTVP |
| Length | 333 |
| Position | Tail |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.608 |
| Instability index | 89.47 |
| Isoelectric point | 9.09 |
| Molecular weight | 36614.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27222
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.64| 18| 19| 22| 40| 1
---------------------------------------------------------------------------
16- 33 (32.32/ 8.66) MPMMSSP..SPVQQAQTPQS
34- 53 (33.33/10.93) MPPPPQPspQPGQPTSQPNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.38| 20| 28| 57| 82| 2
---------------------------------------------------------------------------
57- 79 (36.05/13.47) SGPAPSPssfLPSP.SPQPSQSPA
88- 108 (35.33/ 9.68) SVPSPGP...LNTPvNPNSVMSPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.91| 23| 28| 149| 175| 3
---------------------------------------------------------------------------
140- 167 (35.21/19.42) DKNEdrkkdLSKMKSLLDILTDPSKRCP
172- 196 (39.70/14.85) QKCE...iaLEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
|