Description | Uncharacterized protein |
Sequence | MWKFFKKAVSSKIAPSMLILALLSSTVIPNRRLYPMAYRLYMELLKRYTFFIYI |
Length | 54 |
Position | Tail |
Organism | Vitis vinifera (Grape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> Vitales> Vitaceae> Viteae> Vitis. |
Aromaticity | 0.19 |
Grand average of hydropathy | 0.467 |
Instability index | 45.33 |
Isoelectric point | 10.35 |
Molecular weight | 6524.95 |
Publications | PubMed=17721507 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27195 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) FFIYI 2) MWKFFKKAV | 50 1 | 54 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab