| Description | Uncharacterized protein |
| Sequence | MWKFFKKAVSSKIAPSMLILALLSSTVIPNRRLYPMAYRLYMELLKRYTFFIYI |
| Length | 54 |
| Position | Tail |
| Organism | Vitis vinifera (Grape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> Vitales> Vitaceae> Viteae> Vitis. |
| Aromaticity | 0.19 |
| Grand average of hydropathy | 0.467 |
| Instability index | 45.33 |
| Isoelectric point | 10.35 |
| Molecular weight | 6524.95 |
| Publications | PubMed=17721507 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP27195 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) FFIYI 2) MWKFFKKAV | 50 1 | 54 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab