<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27186
| Description |
Uncharacterized protein |
| Sequence | MQLDQLIQNTSYSRDTNVRIQPFDLDVLREAFQLRETAPIDLPPAEKGIPTIAGKSKSESKDKERKHKKHKDRDKEKDKEHKKHKHRHNRSKEKDKEKKDRSGQHDSAADHSKKHHEKKRKHDGEEDVNDIQRHKKSKHKSSKIDELGAIKVAG |
| Length | 154 |
| Position | Head |
| Organism | Vitis vinifera (Grape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> Vitales> Vitaceae> Viteae> Vitis.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -1.807 |
| Instability index | 39.70 |
| Isoelectric point | 9.72 |
| Molecular weight | 18008.95 |
| Publications | PubMed=17721507
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27186
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.24| 14| 14| 67| 80| 1
---------------------------------------------------------------------------
67- 80 (26.65/11.21) H.KKHKDRDKEKDKE
84- 97 (26.90/11.39) H.KHRHNRSKEKDKE
111- 125 (21.69/ 7.65) HsKKHHEKKRKHDGE
---------------------------------------------------------------------------
|