<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27183

Description Uncharacterized protein
SequenceMAASKAEGKAIGIDLGTTYSCVGVWLHDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFSDPSVQGDMKLWPFKVVPGPGDKPFIVVQYKGEEKKFTAEEISSMVLVKMRETAEAFLGHSVNNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAAIAYGLDKKASRKGEQNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVSEFRRKHKKDIGGNARALRRLRTACERAKRTLSSTTQTTIEIDSLYEGTDFYATITRARFEELCMDLFRKCMEPVEKCLRDAKIDKGQVHEVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIEKLVKDAEQYKAEDEEVKRKVEAKNSLENYAYNMRNTVKDEKIAGKLSGPDKQAIEKAVEDTIGWLEGNQLAEVEEFEDKLKELEGICNPIIAKMYQGSGGDASMGGAGDMPGAGYGGSTGSGGGAGPKIEEVD
Length656
PositionUnknown
OrganismVitis vinifera (Grape)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> Vitales> Vitaceae> Viteae> Vitis.
Aromaticity0.06
Grand average of hydropathy-0.383
Instability index32.73
Isoelectric point5.31
Molecular weight71401.03
Publications
PubMed=17721507

Function

Annotated function 
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central

GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27183
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.99|      12|      17|     618|     631|       1
---------------------------------------------------------------------------
  618-  631 (21.84/18.74)	YQGSGGdaSMGGAG
  638-  649 (26.15/15.20)	YGGSTG..SGGGAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.88|      16|      17|     567|     583|       2
---------------------------------------------------------------------------
  567-  583 (22.96/18.45)	GKLSGPDKQAIEKaVED
  586-  601 (28.93/18.51)	GWLEGNQLAEVEE.FED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     156.41|      41|      41|     305|     345|       3
---------------------------------------------------------------------------
  305-  345 (70.07/51.20)	TR.ARFEELCMDLFRKCMEPVEKCLRDAKIDKG.QVHEVVLVG
  348-  389 (54.24/37.90)	TRiPKVQQLLQDFF.NGKELCKSINPDEAVAYGaAVQAAILSG
  392-  421 (32.10/19.29)	......NEKVQDLLLLDVTPLSLGLETA....G.GVMTVLI..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.98|      17|      21|      39|      56|       5
---------------------------------------------------------------------------
   39-   56 (26.00/22.67)	NRT..TPSYVAFtDTERLIG
   61-   79 (24.98/16.31)	NQValNPNNTVF.DAKRLIG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27183 with Med37 domain of Kingdom Viridiplantae
Unable to open file!