<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27161

Description Uncharacterized protein
SequenceMDGWMDGWMNEWMDGWMEILMKPSSSNFELSLVMFNAHGSYCSCLVQRSGWTRDVDLFLQWLSALPFAGGGFNDAAIAEGLAEALMMFSVAANGSQTQQNVDGQRHCILVAANNPYPLPTPVYQPQMQNMEQNESIESQTESRLSDAEAVAKSFAQCSVSLSVICPKQLPKLKSIYNAGKRNPRVADPPVDNVKNPHFLVLISDSFMEARAALSRPGLSNMTANQSPVKMDIASVPQVSAAPPASIPSVNGIMNRPTIAVGAVPTATVKVEPSTVTSITSGPGFPHIPSVPRAASQGVPSLQTSSPSSTSQEMISNGDNVQDLKPIVSGISQTLRPVVPAAANVSILNNLSQARQVMHSAALSGGTSIGLQSMGGTSMAMHMSNMISSGMASSVPATQTVFSSGQSAVSSITGSGTLAGTAQVAQNSALGSFTSATSNMSVNSNLGISQPLSNLQGGVSMGQTVPGMSQGNLPGGQMVQSGIGMNQNMMSGLGPSGISSGTGTMIPTPGMSQQVQPGMPSLGVNNNAAANMPLPQQTSGAMQTAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASESLAANWPATMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGLKEGIYMPERKYVLDLLKETVMLGCKPT
Length689
PositionUnknown
OrganismVitis vinifera (Grape)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> Vitales> Vitaceae> Viteae> Vitis.
Aromaticity0.05
Grand average of hydropathy-0.079
Instability index50.39
Isoelectric point8.06
Molecular weight72614.17
Publications
PubMed=17721507

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
transcription regulator complex	GO:0005667	IBA:GO_Central

GO - Biological Function
DNA binding	GO:0003677	IEA:EnsemblPlants

GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
jasmonic acid mediated signaling pathway	GO:0009867	IEA:EnsemblPlants
positive regulation of defense response	GO:0031349	IEA:EnsemblPlants
positive regulation of flower development	GO:0009911	IEA:EnsemblPlants
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central
red, far-red light phototransduction	GO:0009585	IEA:EnsemblPlants
response to far red light	GO:0010218	IEA:EnsemblPlants
response to red light	GO:0010114	IEA:EnsemblPlants
trichome branching	GO:0010091	IEA:EnsemblPlants
trichome papilla formation	GO:1905499	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27161
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     318.35|      44|      50|     427|     470|       1
---------------------------------------------------------------------------
  213-  250 (28.51/ 6.71)	.L.SRPgL...SNMtanQSPVKMD.....iA....S.........VPQVS.......................AAPPASIPSVN
  251-  312 (34.16/ 9.41)	GImNRP.T...IAV....GAVPTAtvkvepS....T.........VTSITSGpgfphipsvpraAS.QGVPSLQTSSPSSTSQE
  313-  350 (43.74/14.01)	MI.SNG.....DNV...Q...DLK......P....I.........VSGISQ...............tLRPVVPAAANVSILNNL
  351-  390 (28.52/ 6.71)	SQ.ARQ.VmhsAAL...SGGTSIG.....lQ....S.........MGGTSMA.........mhmS...........NM.ISSGM
  391-  445 (43.61/13.95)	AS.SVP.A...T.....QTVFSSG......QsavsS.........ITG..SG.tlagtaqvaqnSA.LGSFTSATSNMSVNSNL
  446-  488 (52.97/18.44)	GI.SQP.L...SNL...QGGVSMG......Q....T.........VPGMSQG...nlpggqmvqSG.IG..........MNQNM
  491-  527 (53.50/18.69)	GL.G.P.....SGI...SSGTGTM......I....P.........TPGMSQQ............VQ.PG.MPS....LGVNNNA
  528-  585 (33.33/ 9.02)	AA.NMP.L..pQQT...SGAMQTA......Q....SkyvkvwegnLSGQRQG.......qpvfiTR.LEGYRSASASESLAAN.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.09|      17|      42|     627|     645|       2
---------------------------------------------------------------------------
  627-  645 (22.15/23.86)	LQEKKLcaVIQLPSQTLLL
  668-  684 (28.93/21.20)	MPERKY..VLDLLKETVML
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27161 with Med25 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PLSNLQGGVSMGQTVPGMSQGNLPGGQMVQSGIGMNQNMMSGLGPSGISSGTGTMIPTPGMSQQVQPGMPSLGVNNNAAANMPLPQQTSGA
2) VEPSTVTSITSGPGFPHIPSVPRAASQGVPSLQTSSPSSTSQEMISNGDNVQD
450
270
540
322










Molecular Recognition Features






MoRF SequenceStartStop




NANANA