<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27144
Description |
Uncharacterized protein |
Sequence | MGTFLQWLSAISFSGDGYDDLAIAEGLADALLMFPRHPHGTQTQQRLLGRRHCILVAASNPFPFPIPVHLPKIQNLQGAQISGATTEFSLADPNMVAKLFTQFLILISKNFPEAHAALNEYNVTSTPSIQNPV |
Length | 133 |
Position | Unknown |
Organism | Vitis vinifera (Grape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> Vitales> Vitaceae> Viteae> Vitis.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.080 |
Instability index | 34.61 |
Isoelectric point | 6.15 |
Molecular weight | 14527.49 |
Publications | PubMed=17721507
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP27144
No repeats found
No repeats found
|