<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27141
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKMVGKGKLPVESEDAQKLRFQVELEFVQCLANPNYLHSQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSSNSSNNGAGGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP |
| Length | 267 |
| Position | Middle |
| Organism | Anopheles gambiae (African malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.375 |
| Instability index | 42.27 |
| Isoelectric point | 9.02 |
| Molecular weight | 27705.59 |
| Publications | PubMed=12364791
PubMed=14747013
PubMed=17210077
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27141
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 197.22| 42| 45| 132| 174| 1
---------------------------------------------------------------------------
132- 174 (79.21/30.33) GGQPVGGGVQGtLLSNDPAIMPNSSSNNGSNNGSSN..SS........NNGAG
176- 222 (61.06/19.80) GGTGGVGGVGG..ISNA....NNGSSNNGPNSGSVNvpSSvgqqqqqqQNGAG
232- 260 (56.94/18.01) GGGVVGGG..G.MLGNPMGAL...........GGGG..SS........LPGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.41| 22| 25| 19| 43| 2
---------------------------------------------------------------------------
19- 43 (34.12/38.35) QKLRFQVELEFVQCLanpNYLHSQR
68- 89 (41.28/34.51) KYLKFPMCLYFLDLL...QYEHFRR
---------------------------------------------------------------------------
|