<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27132
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MRRVSPADAQKLGYVARVPLRDKWLQQYPMIENRTGPQTIEFLTKRIVALGAVQVGQFLVDCETYMSVPQLGKFHVQVSVVVSVSTRLLAQMAVAWPFKDAFCYLVLLFV |
| Length | 110 |
| Position | Head |
| Organism | Acromyrmex echinatior (Panamanian leafcutter ant) (Acromyrmex octospinosus echinatior) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Acromyrmex.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.330 |
| Instability index | 44.60 |
| Isoelectric point | 9.56 |
| Molecular weight | 12474.64 |
| Publications | PubMed=21719571
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27132
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.82| 14| 14| 54| 67| 1
---------------------------------------------------------------------------
54- 67 (26.28/17.35) QVGQFLVDCETYMS
70- 83 (23.53/14.98) QLGKFHVQVSVVVS
---------------------------------------------------------------------------
|