Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MTPPMERIQILETIEKDIVVCLQSAGQACMELSKEKSSLKQAESQTHQFLKTLGQLESKLSEQINYLTQVSTGQPHEGSGYASQKVLQMAWHRLEHARSRVNELERIKNKLR |
Length | 112 |
Position | Head |
Organism | Acromyrmex echinatior (Panamanian leafcutter ant) (Acromyrmex octospinosus echinatior) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Acromyrmex. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.648 |
Instability index | 55.80 |
Isoelectric point | 8.62 |
Molecular weight | 12805.54 |
Publications | PubMed=21719571 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27120 No repeats found No repeats found |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) SGYASQKVLQMAWHRLEHARSRVNELERIKN 2) SQTHQFLKTLGQLESKLSEQINYLTQVSTGQPHE | 79 44 | 109 77 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab