<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27114

Description Mediator of RNA polymerase II transcription subunit 30
SequenceMAGQQHPFLSGFPNVQQSAMRTQFGGGQMVSGLMGPQQGNMVSSQQFGMGVGVGVGVGNVGSNAMGMPNSQQVLAQQQQQQQSMAMQQQMQQMQQQQLQLQQQQQAAMVQQNNQTNNQATTPQTPVPPTQPPPRQQQTKEFNTASLCRFGQESVQEIVSRTLELFQTLKVLQPPNGTAQGANMANEKKKKVYEQLEMIKIMFKRLRLIYEKCNENCQLQGMEYTHIESLIPLKEEWDMKSDEKKTSETYRLSCEERKEVMEVRRE
Length265
PositionHead
OrganismAcromyrmex echinatior (Panamanian leafcutter ant) (Acromyrmex octospinosus echinatior)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Acromyrmex.
Aromaticity0.05
Grand average of hydropathy-0.827
Instability index54.64
Isoelectric point8.32
Molecular weight29991.77
Publications
PubMed=21719571

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27114
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.74|      19|      22|      76|      96|       1
---------------------------------------------------------------------------
   76-   96 (28.64/14.46)	QQQQQQqSmAMQQQMQQMQQQ
  100-  118 (32.09/ 9.53)	LQQQQQ.A.AMVQQNNQTNNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.03|      21|      28|      16|      42|       3
---------------------------------------------------------------------------
   16-   36 (41.50/24.40)	QQSAMRTQFG.G.GQMVSGLMG.P
   45-   68 (28.53/ 6.73)	QQFGMGVGVGvGvGNVGSNAMGmP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27114 with Med30 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VGNVGSNAMGMPNSQQVLAQQQQQQQSMAMQQQMQQMQQQQLQLQQQQQAAMVQQNNQTNNQATTPQTPVPPTQPPPRQQQTKEFNTAS
57
145










Molecular Recognition Features






MoRF SequenceStartStop




NANANA