<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27110
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MATDDSWKTSHFRQSVVAIIDEAIQVSGMPTTKNSIEMENHVFQKAKSKEEYLGFVARLILHVREMNSKKSATGNAPGTAGTNNQGMPDPIGALQTLARQGTGNNQMMSMGGPNHQGIISQPPTNTATNLLQSLNQRPAQPINMPGIQNKMPGMGMMPSQTGGPMNHMGPIQNMQNNPMLTQMNQMGQGNIPPQMNQMVPGQMGQLGAGQMQQNMQSQMQTQLPGQMNNQITGPMGNIQTSISQQMNQIGPGQLGPGQMQQQLNHIQRKPSEMMNTGFPGPRNVTPNQFLRQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAIMTGPTRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRRMIAKMSNEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKLDFKRGDSSVGPPVTTLKEHQIFSPLLEAVSAHLQSPVINHTLQRTFGPCLDALFGPEIKNLPPPLKKQKIEESSSEIPDVLQGEIARLDQRFKVSLDPAQQSGSRCIQLICWLDDRHLPCVPPISVTVPADYPSTPPRCVMAPHEYEATTFLCAVQKALNIRIAKLPRRFSLSQLLDTWEMSVRQASAPKEMSITASTVLMGL |
| Length | 633 |
| Position | Tail |
| Organism | Acromyrmex echinatior (Panamanian leafcutter ant) (Acromyrmex octospinosus echinatior) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Acromyrmex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.475 |
| Instability index | 58.82 |
| Isoelectric point | 9.34 |
| Molecular weight | 68797.43 |
| Publications | PubMed=21719571
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27110
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 179.30| 22| 23| 182| 203| 1
---------------------------------------------------------------------------
138- 157 (31.96/10.47) PAQ....PIN.MPGIQNKMPGMG.MM
158- 177 (28.01/ 8.24) PSQT.ggPMN.HMG....PIQNMQNN
178- 199 (37.91/13.83) P...mltQMN.QMGQGNIPPQMNQMV
200- 215 (24.54/ 6.28) PGQM......gQLGAG....QMQQNM
256- 278 (27.93/ 8.19) PGQM.qqQLN.HI.QRKPSEMMNTGF
294- 313 (28.95/ 8.77) PSPS...APS.PAGLG..APSSNQMV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.10| 20| 22| 389| 408| 2
---------------------------------------------------------------------------
389- 408 (31.93/22.99) MSNEGNVDKLSKMKKLLEIL
411- 430 (32.17/23.23) PSKRMPLDTLLKCEVVLEKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.94| 19| 20| 218| 236| 3
---------------------------------------------------------------------------
218- 236 (37.65/16.60) QMQTQLPGQMNNQITGPMG
237- 255 (34.29/14.51) NIQTSISQQMNQIGPGQLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.91| 17| 22| 442| 463| 4
---------------------------------------------------------------------------
442- 458 (29.57/23.42) PVTTLKEHQIFSPLLEA
466- 482 (32.34/14.14) PVINHTLQRTFGPCLDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.76| 14| 20| 589| 602| 7
---------------------------------------------------------------------------
589- 602 (23.12/16.67) LNIRIAKLPRRFSL
611- 624 (23.65/17.24) MSVRQASAPKEMSI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.36| 10| 30| 528| 537| 11
---------------------------------------------------------------------------
528- 537 (19.62/11.31) PAQQSGS..RCI
559- 570 (15.74/ 7.59) PADYPSTppRCV
---------------------------------------------------------------------------
|