<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27104
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MATPTNSDCNLVDEFEESFQQCLSILTKDEGLGNSGTGASGGLTVDKDEGRAEIEQATMRFIDLARQMEAYFLQKRFLLSALKPEMLVKEEINELKLELARKEELIKRHNDKIAVWQNMLSDLQGWAQSPAQGPAPSGLPNGNQSGQNQQATGGSGNASMQQQQQILQHQQQLQQQLQQQQQQQQHPQLQQQLQQQMQHPLQSQVQQGSGGPPTSGLQGVGVPVNQQGMFMTQGGVGGRATGFPVGGMGSSALQGPLAYLEKTTSNIGMPERRS |
Length | 274 |
Position | Head |
Organism | Acromyrmex echinatior (Panamanian leafcutter ant) (Acromyrmex octospinosus echinatior) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Acromyrmex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.728 |
Instability index | 68.60 |
Isoelectric point | 5.28 |
Molecular weight | 29850.00 |
Publications | PubMed=21719571
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27104
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.09| 18| 18| 161| 178| 1
---------------------------------------------------------------------------
161- 178 (36.50/14.15) QQQQQILQHQQQLQQQLQ
181- 198 (37.58/14.77) QQQQQHPQLQQQLQQQMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.87| 13| 18| 216| 233| 2
---------------------------------------------------------------------------
216- 228 (24.26/17.89) GLQGVGVPVNQQG
237- 249 (25.62/ 7.34) GGRATGFPVGGMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.52| 10| 55| 144| 154| 5
---------------------------------------------------------------------------
144- 154 (15.55/10.37) QSgQNQQATGG
202- 211 (19.97/ 8.57) QS.QVQQGSGG
---------------------------------------------------------------------------
|