<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27099
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSLDQVIQDAITDRAVELFLVSNMCPICESNAYLNPNFRYGYHSKRIVPKLNRSSKTFNPKLQKQLIKENCQDLKEEVNEGIHFKTLIEPPNLDFIEERGGFTCFGDWETWPGKSSRAMLEECKEALQALLNTLFYSYLKLLNQLSNQGPPSLWNQSQTNQVSKIDQIISHIKLTPFNMHGLCNEIRPRQTIEGMHCYLL |
| Length | 200 |
| Position | Middle |
| Organism | Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Melampsoraceae> Melampsora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.440 |
| Instability index | 51.07 |
| Isoelectric point | 6.52 |
| Molecular weight | 23125.28 |
| Publications | PubMed=21536894
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27099
No repeats found
|