<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27096
| Description |
Uncharacterized protein |
| Sequence | MSLMFRKFNRTTNPRMNEPASNSNLSNSMPSTSELPMASPSLVFDPVHNAGRLLSHFSHLEDLLRLVRRTRHALPALVQEANNLPKSGAIESWNCLKQENLKNVQDLKEAIMNSQDAFLFVRSSSRLDETDFKIDDQMPDETAAAVAHMKKLAPRSLFQKHSDGSSGRISVPFALQTLQPGFEAAIKLINESYGLQAISWQEHITRPGRTSWVEVKVRGVLRALVTVREYPDPNNGSRSITRIERGVCFGVHEPRKHVYEQSDYGIFQSISRCLNTTIDEHPKRGSDNVYLVCTFLASYLDLFQPINPTLANPNQDNANPSKILYPQVWRIWRTAADDQAGQQTGGWDPMEEPR |
| Length | 354 |
| Position | Tail |
| Organism | Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Melampsoraceae> Melampsora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.532 |
| Instability index | 49.25 |
| Isoelectric point | 7.75 |
| Molecular weight | 39997.71 |
| Publications | PubMed=21536894
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27096
No repeats found
|