<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27092
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MTSTIAGLKIPSADLCHVQWRSLAWVLENGPLNETNAMEYFSHSPFYDRRSTNQVLRMQSMFSGQPPLDSKAEKEALKKLVGIEYTLVVSKPEDDREGGLFVIEKRDRKNPEESYPITSYYILKTCIYQSPSFHAALSCRLLTSLSSLSDLLDLARSRKPIYDPQQGYAWKIKTRHQGFEGGSNTNEHQDQDPNQPELSAYEAQPISPVQRRRPSNHLPMDIDKLETSNTKITPTGVRNPLDDKVEVRNIPLERAFQNALAMFSKPDDNPTQPSITITEVNHSSNPQDDLNNLSQAELNLINSNSSFNLSHSSNDTQSQESLMDETIGGKKTNSSGKRKVKRTT |
| Length | 344 |
| Position | Head |
| Organism | Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Melampsoraceae> Melampsora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.795 |
| Instability index | 50.45 |
| Isoelectric point | 6.27 |
| Molecular weight | 38754.80 |
| Publications | PubMed=21536894
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27092
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 270.82| 69| 172| 28| 150| 1
---------------------------------------------------------------------------
28- 96 (116.23/51.29) E...NGPLNETNAMEYFSHSP......FYDRRSTNQVLRMQSMFSGQPPLD.SKAEKEALKKLVGIEYTLVVSKPEDDR
173- 244 (95.60/112.26) KtrhQGFEGGSNTNEHQDQDPnqpelsAYEAQPISPVQRRRP..SNHLPMDiDKLETSNTK....ITPT.GVRNPLDDK
246- 289 (58.99/16.98) .............................EVRNI.PLER...AFQNALAMF.SKPDDNPTQPSITITEVNHSSNPQDD.
---------------------------------------------------------------------------
|