<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27089

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAATTSSQNGTILQSNGTCPPPSNTSNRPSKSIKGKGKADCESLPQKLPSHPLPVPPPLPPPCLENITDDEKLRKIAELDEKELGRHWGPHLIPLQIVIQRTIAQVFRELQLVAETSPSLDDFERKKRVIDFVIHSRRQIIKLLVLVKWSANAGPTHKIMQQLHIYFTIVGFLQRQNQQFQRTVEILKASKNSFYSARMKNFDISTSLQVLTQGYPNLPESLLERFSTKPRLKNSEVARLMHNLDNAIRFRLGATREVLPKEFRSYTIANGRVTFRVKNMFECSATLSGGQADAIWYLLHVKFLFKVLNPHGREFPTTIYGDAKQHIIEAANHGMAHRCLPTQADPDPKPPARPLMRLFAFLRELSLNYQLESLHYQASQLERTAWCPHTRLFMPPDRSSLTIHYWSYARPPPKIVLRVGQQRPKKPPPVAQGSITIRRKTEKQGVTKTRISDFLKGYPLMEKKQSDNEDDDGDHGASYTKRLQVVWVPFEISQLSIPPPPPPPTANQTRIPPPVVHKPPTITPQILESLLIEPNNGILFKPDGKGGLELEVEYTELDLEHIILKAVRAQMDCMLRRAYLQLVAMPTPEWHPSLSPLLPYFPSVTPIQFEPFPTPRQAFHIPSSSPLCPQVKAIRVALHGRHVIKVTLDKYSGRFKILPVLVDRISDFKDKMDGDLVVIGEKEFVSADYSSCSRRININPPGMKNLLIYLKSQVLLEQVEDKGIRMGLRAFRDMPVQWRELIIHSPRGMNRNVPPPIYHHIFPMITYFDLPGFPDYYLTILVKETGFQCSLSLLRSVDGKRNLTVQDNVEILVPTFDENELEEDEDGIKAQIDDKFVLSRRQLKYIHHQSMVQAAIHSICKQLHTTKVPFRRILPIPIKMMRKYGPLKLHPSSQPIGLLMLPTQTCFKAGLLDYLHPNFAIRVSVTPPKGIKLSGIKTDEISTHTLCGYLSMIID
Length955
PositionTail
OrganismMelampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Melampsoraceae> Melampsora.
Aromaticity0.08
Grand average of hydropathy-0.330
Instability index49.89
Isoelectric point9.50
Molecular weight108703.18
Publications
PubMed=21536894

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP27089
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     492.86|     175|     476|      20|     272|       1
---------------------------------------------------------------------------
   20-  234 (256.29/169.53)	PPPSNTSNRPSKSIK..GKGKAD.CeSLPQKlPSHPLP......VPP..P.......LPP..PCLENI...TDDEKLRKIAELDEKELGR.HWGPHLiPLQIVIQRTI.AQ...VFRE..LQLVA....ETSPSL...............DDFERKKRVidFVIHSR................RQIIKlLVLVKWSANagpthkimqqlhiyFTIVGFLQRQNQQFQRTV..EILKASKNSFYSArmknfDistslqvltqgYPnlpeSLLERFS.TKPRLKN
  315-  389 (52.36/33.07)	FPTTIYGDAKQHIIEaaNHGMAHrC..LPTQ..ADPDP......KPParP.......LMRlfAFLREL...SLNYQLESL.HYQASQLERtAWCPH...........................................................................................................................................................................................
  496-  705 (184.21/74.85)	..........................SIP...PPPPPPtanqtrIPP..PvvhkpptITP..QILESLliePNNGILFKPDGKGGLELEV.EY.TEL.DLEHIILKAVrAQmdcMLRRayLQLVAmptpEWHPSLspllpyfpsvtpiqfEPFPTPRQA..FHIPSSsplcpqvkairvalhgRHVIK.VTLDKYSGR..............FKILPVLVDRISDFKDKMdgDLVVIGEKEFVSA.....D...........YS....SCSRRINiNPPGMKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.52|      13|      14|     401|     413|       2
---------------------------------------------------------------------------
  401-  413 (27.36/13.36)	LTIHYWSYARPPP
  417-  429 (25.16/11.68)	LRVGQQRPKKPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.82|      20|     137|     756|     776|       6
---------------------------------------------------------------------------
  756-  776 (39.33/31.94)	PIYHHIFPMITYFDlPGFPDY
  895-  914 (38.49/25.92)	PIGLLMLPTQTCFK.AGLLDY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP27089 with Med14 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MAATTSSQNGTILQSNGTCPPPSNTSNRPSKSIKGKGKADCESLPQKLPSHPLPVPPPLPPPCLENI
1
67

Molecular Recognition Features

MoRF SequenceStartStop
1) IHYWSYAR
403
410