<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27083
| Description |
Uncharacterized protein |
| Sequence | MTSHDDELSRNMDRITQLQDGIDNLVTIMYSTVSYLSRKADFEQVNPDIPITQSISDPTKIDQAKETFNQNCQELVEDFIRKAKQLEYLISILPPHDDSSTIPLPNTTDPPQATSSSLSSSPTNHNRVYTISSSTCTEPDGTKVSSPITKPTNGEISSDQNHSVDEDDELGTDKDEFNRLQRDIEDAQAEYEHALSIAESLHSEIKSILKLVLEKRSQSGAMSP |
| Length | 224 |
| Position | Middle |
| Organism | Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Melampsoraceae> Melampsora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.752 |
| Instability index | 49.57 |
| Isoelectric point | 4.48 |
| Molecular weight | 24942.04 |
| Publications | PubMed=21536894
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27083
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.66| 24| 27| 101| 124| 1
---------------------------------------------------------------------------
101- 124 (43.37/21.83) TIPLPNTTDPPQATSSSLSSSPTN
130- 153 (43.29/21.78) TISSSTCTEPDGTKVSSPITKPTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.98| 20| 160| 5| 24| 2
---------------------------------------------------------------------------
5- 24 (35.59/24.88) DDELSRNMDRITQLQDGIDN
167- 186 (35.38/24.70) DDELGTDKDEFNRLQRDIED
---------------------------------------------------------------------------
|