<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27082
Description |
Uncharacterized protein |
Sequence | MSTEISATGLVSIELRQSVLDRLATHSHSVCHFLAREVIFDRGPLDEFPADTQMLRLRHTLQTPDFSQPKETGTGWTLISLGRPEPERLSPEFLIRPIYTGPVLEGEPFERKFEYYRRGLVFTRGPVLTEIYQVHSTPTDPPIEWRDTYLISVTVIIPPANTTGRSIQELREEASERIRGIQGYLKGLVDLGRVEPF |
Length | 197 |
Position | Head |
Organism | Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Melampsoraceae> Melampsora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.333 |
Instability index | 46.94 |
Isoelectric point | 5.60 |
Molecular weight | 22460.29 |
Publications | PubMed=21536894
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27082
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.92| 17| 25| 64| 84| 1
---------------------------------------------------------------------------
64- 84 (26.92/22.30) PDF.SQPKETGTgwtlISLGRP
91- 108 (29.00/13.72) PEFlIRPIYTGP....VLEGEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.80| 13| 14| 130| 142| 2
---------------------------------------------------------------------------
130- 142 (25.14/14.44) EIYQVHSTPTDPP
147- 159 (22.65/12.42) DTYLISVTVIIPP
---------------------------------------------------------------------------
|