<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27080
Description |
Putative mediator complex subunit 21 |
Sequence | MDLLTQLQDKLDHLFLVFGTCIGVLQRDAPPSSFSEVMNNQPPQLTQEQLTNADNWNSQTKHMALQVIETTKLIESIIESLPGFQRTENEQYQRLKALNHESKLLQQQLQDKENENDLFVDQSPKQVNPLTTNQST |
Length | 136 |
Position | Middle |
Organism | Cavenderia fasciculata (strain SH3) (Slime mold) (Dictyostelium fasciculatum) |
Kingdom | Amoebozoa |
Lineage | Eukaryota> Amoebozoa> Evosea> Eumycetozoa> Dictyostelia> Acytosteliales>
Cavenderiaceae> Cavenderia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.725 |
Instability index | 61.43 |
Isoelectric point | 4.70 |
Molecular weight | 15620.28 |
Publications | PubMed=21757610
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27080
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.16| 18| 57| 40| 57| 2
---------------------------------------------------------------------------
40- 57 (34.20/16.87) NQPPQLTQEQLTNADNWN
99- 116 (30.97/14.73) NHESKLLQQQLQDKENEN
---------------------------------------------------------------------------
|