<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27067
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MTTKLGTTNPAILSSGKTYQCSLYGELPHTGLGKLLERLVGLCGETKHLGLARFCEHQIAFVPAVQTPFGPPRNDDILLRLHSNVLDAESNFIHFLDREWTLLHLSPAEPPKAGQKLANHRAIHHTRITGDVIKYIEMLGYKFEFEVVRRGFTFQFGQVRIDIFRLYQIQDQFRVSSAIPVVSNSTTWIVQVTSPILGQEHVVHMSDNLFQFAAHLSG |
| Length | 218 |
| Position | Head |
| Organism | Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) (Frog chytrid fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Rhizophydiales>
Rhizophydiales incertae sedis> Batrachochytrium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.068 |
| Instability index | 24.30 |
| Isoelectric point | 7.85 |
| Molecular weight | 24574.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27067
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.18| 16| 16| 23| 38| 1
---------------------------------------------------------------------------
23- 38 (29.42/17.64) LYGELPHTGLGKLLER
42- 57 (31.76/19.52) LCGETKHLGLARFCEH
---------------------------------------------------------------------------
|