<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27064
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNAIASAKHKSLARSNIDSSAADMDKVSAPLAVLEKLKTLDIHLQSYRQSVESHQNLVLQVQAMKQDLDNRNKSVLMKMKRLHQAHEGLDSVLANARYKQKLMHKANQGSIDFNELLSYAQRVSKHTMSPINPNTWVIEPPIPQDSHMRMSLLFRQDQLLTEKTVQDDASNAGDHTMDLDLLSHDLPESSDHDAMHAETLLDLDFE |
| Length | 206 |
| Position | Middle |
| Organism | Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) (Frog chytrid fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Rhizophydiales>
Rhizophydiales incertae sedis> Batrachochytrium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.578 |
| Instability index | 57.14 |
| Isoelectric point | 5.92 |
| Molecular weight | 23286.08 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
RuleBase:RU364141
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27064
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.97| 11| 19| 78| 88| 2
---------------------------------------------------------------------------
78- 88 (20.74/12.75) KMKRLHQAHEG
99- 109 (20.24/12.30) KQKLMHKANQG
---------------------------------------------------------------------------
|