<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27063
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDPTRVLSAAYPAPPAYYKNYTDENLALVKAGGTAFSTTDNLSSQLSVNLKPPNPVLEPISVFGTILDTSYKIEHIRLILINFHSLLNEYRPHQARDTLAIMMRDQIRRRKETTQSIRDEITKAQTLSADSGSDTLMSDL |
Length | 140 |
Position | Middle |
Organism | Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) (Frog chytrid fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Rhizophydiales>
Rhizophydiales incertae sedis> Batrachochytrium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.373 |
Instability index | 40.66 |
Isoelectric point | 6.27 |
Molecular weight | 15682.61 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP27063
No repeats found
No repeats found
|