<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27054

Description U-box domain-containing protein kinase family protein
SequenceMEEKKVVRALSEHLSLPPPPSPSVAVAINGKKKSKYVVFWALEKFIPEGFTDFKLLYVRPPVSYIPTPMGIAVAVSELREDVVSAYKQELDWSANEMLRPYKKMFERRKVQVEVLLLDSLEPAAAIAEEIAGTGVTKLVIGMSLRGFFSRKIDMSSLIATAVPRFCTVYVISKGKLASVRPSESDASGSIRFERSSSTSGSTDSPRLPPEYQDFLSAVSEAQSRVSPFSPALKHSMGSNAVAQMDTSSSGTDQEEVSTGRGMEIVHSGIEGKKNKDESFSASFPMGTEAYNSMSWTSKWRDHEDRREMRSSSSSNNHDLVNMDWGAVVPENYSWVSHTASHMSDGLLSVHSITDNQVNLNFEIEKLRAELKHVQEMYAMAQTETVGASKKLTELNQRRFEESEKLVELKEKEEVAKDTASKEKQRYEEAMKEAEKVKELMMKEALHRREAEFKAERDAREKDKLQASLVSPGVQYQHYTWEEIAAATSDFAENLKIGIGAYGSVYKCNLHHTTGAVKVLHAGETQLSKQFDQELEILSKIRHPHLVLLLGACPERGCLVYEYMDNGSLDDRLMLVNDTPPIPWFERFRIALEVASALVFLHKSKPRPIIHRDLKPGNILLDHNFVSKLGDVGLSTMVNQDDVSSRTIFKQTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEFMAILDKKAGSWPISDTRELAALGLCCTEMRRRDRPDLKDQIIPALERLRKVADKAQNLLSRTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWLRQKDTSPVTNLPLPNKNLIANYTLYSAIMEWKSNKRLNFPKEKFLAYHPIQ
Length860
PositionTail
OrganismArabidopsis thaliana (Mouse-ear cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.07
Grand average of hydropathy-0.391
Instability index42.63
Isoelectric point6.25
Molecular weight96458.00
Publications
PubMed=11130714
PubMed=27862469

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27054
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     149.92|      33|     452|     171|     212|       1
---------------------------------------------------------------------------
  171-  203 (49.85/24.84)	ISKGKLASVRPSESDASGSIRFERSSSTSGSTD
  220-  252 (52.49/42.13)	EAQSRVSPFSPALKHSMGSNAVAQMDTSSSGTD
  273-  301 (47.58/26.18)	..KNKDESFSASF..PMGTEAYNSMSWTSKWRD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.67|      17|      36|     358|     375|       2
---------------------------------------------------------------------------
  358-  375 (26.02/23.24)	NLN...F.EIEKLrAELKHVQE
  393-  413 (19.65/11.18)	ELNqrrFeESEKL.VELKEKEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.79|      15|      45|      14|      28|       3
---------------------------------------------------------------------------
   14-   28 (29.04/15.02)	LSLPPP....PSP.SVAVAI
   56-   75 (19.75/ 8.08)	LYVRPPvsyiPTPmGIAVAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.75|      26|     746|      86|     111|       4
---------------------------------------------------------------------------
   86-  111 (46.96/31.58)	YKQELDWSANEMLR.PYKKMFERRKVQ
  834-  860 (42.79/28.10)	YSAIMEWKSNKRLNfPKEKFLAYHPIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.48|      18|      31|     462|     479|       6
---------------------------------------------------------------------------
  462-  479 (31.70/26.35)	DKLQASLVSPGVQYQ...HYT
  492-  512 (26.78/20.93)	ENLKIGIGAYGSVYKcnlHHT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27054 with Med32 domain of Kingdom Viridiplantae
Unable to open file!