<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27053
Description |
Cyclin family protein |
Sequence | MFLIDSFCGFYFHSKELKDPEEVNVVHPLDAQRGISVEDFRLIKLHMSNYISKLAQHIKIRQRVVATAVTYMRRVYTRKSLTEYEPRLVAPTCLYLACKAEESVVHAKLLVFYMKKLYADEKFRYEIKDILEMEMKVLEALNFYLVVFHPYRSLPEFLQDSGINDTSMTHLTWGLVNDTYRMDLILIHPPFLITLACIYIASVHKEKDIKTWFEELSVDMNIVKNIAMEILDFYENHRLFTEERVHAAFNKLATNP |
Length | 256 |
Position | Kinase |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.045 |
Instability index | 42.55 |
Isoelectric point | 6.42 |
Molecular weight | 30213.91 |
Publications | PubMed=11130714
PubMed=27862469
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27053
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.14| 17| 101| 86| 102| 1
---------------------------------------------------------------------------
86- 102 (31.53/17.51) PRLVAPTCLYLACKAEE
190- 206 (30.61/16.85) PFLITLACIYIASVHKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.13| 16| 39| 69| 85| 2
---------------------------------------------------------------------------
69- 85 (24.49/18.90) VTYMRRVYTRKSLtEYE
111- 126 (29.64/18.15) VFYMKKLYADEKF.RYE
---------------------------------------------------------------------------
|