<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27025
| Description |
Uncharacterized protein |
| Sequence | MNTRQQALATAQVYVKRFFTKVSIRRTNPYLLLTTAFYLACKTEECPQHIKYVVSEARGLWPEFILSDSAKVGECEFWLISELNSQLIVHHPYRTLSDFSSTLTNTASSGLTLSSDEIALAWSVVNDSYLTDLPLLQPPHVIAVMAVFVAVVFKPGTSSASTSTGAVGPGTLTSASTSTSTGTGTGPGTGTTSSAGMAAGIREGMGDGGRVQKVVEWLAGSEVSIEAVVDCTQEMVALYEVWEGYGEKGLREAIGRYVRGRFLDK |
| Length | 265 |
| Position | Kinase |
| Organism | Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.038 |
| Instability index | 31.83 |
| Isoelectric point | 5.63 |
| Molecular weight | 28479.96 |
| Publications | PubMed=22951933
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306
ECO:0000256 ARBA:ARBA00003882
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27025
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.70| 15| 15| 159| 173| 1
---------------------------------------------------------------------------
159- 173 (29.22/12.33) SASTSTG.AVGPGTLT
176- 191 (26.48/10.67) STSTSTGtGTGPGTGT
---------------------------------------------------------------------------
|