<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27023
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNPPAPSSPRFTLELEFVLSLANPHYLSHLAVAYPQLLGITSSKDAKDRDSRDSKEKDDSEAFAAYLAYLYDYWRRPEYVQFLSHPGATLRALRLLQEEAFRAAVIRPQVIDMLSQ |
| Length | 116 |
| Position | Middle |
| Organism | Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.349 |
| Instability index | 58.50 |
| Isoelectric point | 5.87 |
| Molecular weight | 13257.87 |
| Publications | PubMed=22951933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27023
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.57| 10| 29| 76| 85| 1
---------------------------------------------------------------------------
76- 85 (19.27/13.08) RPEYVQFLSH
107- 116 (18.30/12.15) RPQVIDMLSQ
---------------------------------------------------------------------------
|