| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MASEKAVFSPADRINELNEVDKDVAQILQSAGLAIQSLTNNTSLPRGELETGSLTTDASLDSRKKAFKSACSQYFALVSSVDVKLRRQVYALEEASIIRAEPTTSFKAGDSMVAGAGATAQLSPGTVNPLETSWLNSRKDTVGKDKEAELWAEASRFMKSVASKKGNENPDSSAAQADAGGKQAMDVD |
| Length | 188 |
| Position | Head |
| Organism | Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) (Horse ringworm fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.423 |
| Instability index | 33.40 |
| Isoelectric point | 5.05 |
| Molecular weight | 19933.95 |
| Publications | PubMed=22951933 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP27017
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.87| 12| 14| 33| 44| 1
---------------------------------------------------------------------------
33- 44 (19.98/14.17) LAIQSLTNNTSL
49- 60 (19.89/14.08) LETGSLTTDASL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DSSAAQADAGGKQAMDVD 2) KDKEAELWAEASRFMKSVASKKGNEN | 171 144 | 188 169 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab