<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27015

Description RNA polymerase II mediator complex component Srb8
SequenceMTISHPPQMSNPYSQPPTGLSDQPTARMALQQQARSGPGSDFGRGLGPGRHGGPGGPGTDASPVIDLTGSNDEDDEDLESSRPAKRLRIDTKGHDEIAGILNAGARLVQGASDDVNDGKSSEVSDQNIPFVESVRPPASFQDRLAYISVDGGGQQSQSSSSPLPLPPRPRRSLFMRDKTETAPEDDEQEDMAVQTTPYTMEKPATAARLADNTILDFHPWTGNHPEDALNEQTAKQGFYDRVQLSQNESNTARPSLYTHFKNPNGLKALSHIFAAALKRRQAMTKVTPNSTFKPPPRVTLTDNKRESWLRDLANPSVPLRRLSRTIPHGIRGKILLDQCLGKNIPIGRAIWLVKCVGANEIRAFKRKGTAATIASGLETKWVKDWTGSVQQFLEGVVQSHEDAGWIENQAYAMRLSGRLFLEQLLDQDAYLEWFLGSLHASNLDMLPVWLSTIGVYWKNLTSYRKRGRRLAQILLDKLAWALNVNRSSVLNPLITRLQSLIRSFITSYPSSFILPLTWSQHQKALTACFNTSVPLETAILAQLIARNARLSKISPQSAINSPQSIPRPAPQQLISLLDAPCASNGFPLLAAKCLALPLDHRTLIHTLLEWSSTPFRYGCARIYASARLLRRWRKLSIDTDAHILSFLAENSKYSARQLDNAYHLVSELVRSQSFSVGKYLEWLMARGAVRSPDTSDQYLTADVELLRHLPSGRLPEHIWNLRNTLLSRAGVSVDAEARQIRQIKTDLLQRHSDIFVGHVGTTDTEMMDGDVDWASLSWTVKSEISHWIREQVALKLRAQAQVQNQPPSNATAQATASTIRPDQFHILRCILERMGDVSILADVLKLLSQSSNPTVLASVTDTLNYHLPSFTAIGATMDLLQNFAISYSKLSKTEVHVQDLIVALLDVAIVIPSEASTVAVLRRDLARYDKKSAMAASSPVSEHMADTLNPVNPTFGGMLDQLLASGNCMDDTTLMRIFDLLIQKLETGKADISITSSEAARYLAQLRLFNPKTFDGLMIKRVVGMIRTSPRPKLSHFLPPLIGVGCITLPAFFGLVKRLLLDADKAGEDNIPDVLHLRLDMLSVLGLGMTDQNTVPDLVFYRFKISRQEFVQKHCCIIVSAIRDAVMDASANHSAADASLHEQWNKAIFPLLCEIMVRHSSLARDECVKWMTEKFPMGLRLLTQTLDSLLGVELSNGNLEILPLPNGDDAGDANLHTDPNRASNGSQSVQQQSSDTIRRIDDFSLPFCLIKLQLLLAETDAAGKENVLDPIFSAAEMDVKKGLSRWVEIITVLDDEGRRQIQQKAENKLLSLFITSASSSSPGNSDDGPAPHELGLVYLRIIEELVSKAPNENISSTIGSALLERMNLLLQRIAFLSKVKSTDSGSTIIAQRNEGGMLGIWIYILLRLVALYRSSFNVERASKTDLSDQTRLLLSICYMAFTPALMQVLSHTTNLPPTPTGKYAHLQRTVPGNWNSLRIYTIDVATILVDTLPDEARIQCARFLRDRSPLFLYQQQDSRLLYLFGPMPDPQAGPISSSTSTTASSAPAPGSSPLNTQGLAAQGSSVQPPHPTNPSIPTVEETTSPVQNFRFQQGNRVIGPCPPRTWEMIEESAPVVGVNDTALNLSYFGARLVRAGLK
Length1638
PositionKinase
OrganismTrichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) (Horse ringworm fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
Aromaticity0.06
Grand average of hydropathy-0.219
Instability index46.66
Isoelectric point7.62
Molecular weight180664.99
Publications
PubMed=22951933

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27015
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     205.23|      73|      79|     466|     543|       1
---------------------------------------------------------------------------
  300-  337 (39.66/16.12)	LTDNKRESWLRDLANPSVPLRR..LSRTipHGIR.GKILLD............................................
  466-  515 (59.20/35.70)	..............................RGRRLAQILLDKlawALNVNRS...SVLNPLITRLQSLIRS..FITSYPSSFILP
  516-  597 (106.37/62.64)	LTWSQHQKALTACFNTSVPLETaiLAQLiaRNARLSKISPQS...AINSPQSiprPAPQQLISLLDAPCASngFPLLAAKCLALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     263.52|      82|      84|    1233|    1314|       3
---------------------------------------------------------------------------
 1233- 1314 (137.23/90.76)	SSDTIRRIDDFSLP..FCLIKLQLLLAETDAAGKENVLDPIFSAAEMDVKKGLSRWVEIITVLD.DEGRRQIQQKAENKLLSLFI
 1318- 1402 (126.29/82.86)	SSSSPGNSDDGPAPheLGLVYLRIIEELVSKAPNENISSTIGSALLERMNLLLQRIAFLSKVKStDSGSTIIAQRNEGGMLGIWI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.20|      10|      25|     197|     206|       4
---------------------------------------------------------------------------
  197-  206 (19.36/10.34)	PYTMEKPATA
  219-  228 (21.84/12.64)	PWTGNHPEDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     118.43|      38|      77|     950|     992|       5
---------------------------------------------------------------------------
  950-  992 (54.50/59.18)	PvNPTFGGMLDQLLASGnCMddtTLMRIFD....LLIQKLETGKADI
 1030- 1071 (63.93/47.08)	P.RPKLSHFLPPLIGVG.CI...TLPAFFGlvkrLLLDADKAGEDNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.47|      16|      19|    1534|    1549|       9
---------------------------------------------------------------------------
 1528- 1546 (22.72/ 9.50)	PDPqagPISS.STSTTASSA
 1547- 1566 (18.75/ 6.46)	PAPgssPLNTqGLAAQGSSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.99|      11|      17|     669|     680|      13
---------------------------------------------------------------------------
  669-  680 (15.98/11.53)	VRSQSFSvGKYL
  689-  699 (21.01/10.79)	VRSPDTS.DQYL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27015 with Med12 domain of Kingdom Fungi
Unable to open file!