<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27014
| Description |
C-type cyclin |
| Sequence | MAANYWTSTQRRFWLFDREQLAETRAALDEADRAFIAQYPLPDHRLVNIYINQQLIKLGKRMNTRQQALATAQVYVKRFFTKVSIRRTNPYLLLTTAFYLACKTEECPQHIKYVVSEARGLWPEFILSDSAKVGECEFWLISELNSQLIVHHPYRTLSDFSSTLTNTASSGLTLSSDEIALAWSVVNDSYLTDLPLLQPPHVIAVMAVFVAVVFKPGTSSSSSSASTGAAAAAAAAAAGPGTLASASTSTGTGTGSRNRHDKVLPGWRRAYEEGMGDGGRVQKVVEWLAGSEVSI |
| Length | 295 |
| Position | Kinase |
| Organism | Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) (Horse ringworm fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.085 |
| Instability index | 41.29 |
| Isoelectric point | 8.39 |
| Molecular weight | 32355.29 |
| Publications | PubMed=22951933
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306
ECO:0000256 ARBA:ARBA00003882
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27014
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.08| 13| 22| 216| 228| 1
---------------------------------------------------------------------------
216- 228 (24.48/11.13) PGT.SSSSSSASTG
240- 253 (20.60/ 8.54) PGTlASASTSTGTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 30.72| 10| 20| 255| 267| 2
---------------------------------------------------------------------------
255- 267 (11.13/22.63) GSRNRhdKVLPgW
278- 287 (19.59/14.33) GGRVQ..KVVE.W
---------------------------------------------------------------------------
|