<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27013

Description Mediator of RNA polymerase II transcription subunit 20
SequenceMSVTGVYYIPSNPELPTTATRTVIDRFKAIHQPVRLGRWALEFKLVRDTASCLPAANFPHNKVPTPRYMHFLSLSHYQNHGFVRISPRPEVDPLDPAEMEKQMNSPPSVPIPATGVSTQSKPSADSKDSNSPSQNEAHTTTIKTFDPQSYLSFFSMTTKFFQPLWNHRYTVVVTSGEVYEVGDFRVRIGEVRQTMPRPRLRGAIVEIEYRGPGQRQLQPDLTREPEEDWDLAPPLPHYPPREVIIPTDEDWELGVMLIRELWDNFSIPGASESIQVPGLGLERREYFGKGGASAHTARKKASLVGVDLARQYMDVFKFYR
Length320
PositionHead
OrganismTrichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) (Horse ringworm fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
Aromaticity0.10
Grand average of hydropathy-0.528
Instability index50.40
Isoelectric point7.15
Molecular weight36366.80
Publications
PubMed=22951933

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364152
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP27013
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.14|      16|      21|     254|     271|       2
---------------------------------------------------------------------------
  254-  271 (24.61/22.68)	GVMLIRElwDNFSIPGAS
  278-  293 (29.53/18.35)	GLGLERR..EYFGKGGAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.92|      14|      16|      87|     102|       3
---------------------------------------------------------------------------
   87-  102 (17.86/15.37)	PrPEVdPLDPAEMEKQ
  106-  119 (26.05/12.17)	P.PSV.PIPATGVSTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.00|      26|      79|      47|      74|       4
---------------------------------------------------------------------------
   47-   74 (45.42/31.95)	RDTASclPAANFPHN...KVPTPR.YMHFLSL
  127-  156 (39.58/21.26)	KDSNS..PSQNEAHTttiKTFDPQsYLSFFSM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27013 with Med20 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ISPRPEVDPLDPAEMEKQMNSPPSVPIPATGVSTQSKPSADSKDSNSPSQNEAHTTTI
85
142










Molecular Recognition Features






MoRF SequenceStartStop




NANANA