<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27013
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MSVTGVYYIPSNPELPTTATRTVIDRFKAIHQPVRLGRWALEFKLVRDTASCLPAANFPHNKVPTPRYMHFLSLSHYQNHGFVRISPRPEVDPLDPAEMEKQMNSPPSVPIPATGVSTQSKPSADSKDSNSPSQNEAHTTTIKTFDPQSYLSFFSMTTKFFQPLWNHRYTVVVTSGEVYEVGDFRVRIGEVRQTMPRPRLRGAIVEIEYRGPGQRQLQPDLTREPEEDWDLAPPLPHYPPREVIIPTDEDWELGVMLIRELWDNFSIPGASESIQVPGLGLERREYFGKGGASAHTARKKASLVGVDLARQYMDVFKFYR |
| Length | 320 |
| Position | Head |
| Organism | Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) (Horse ringworm fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.528 |
| Instability index | 50.40 |
| Isoelectric point | 7.15 |
| Molecular weight | 36366.80 |
| Publications | PubMed=22951933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27013
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.14| 16| 21| 254| 271| 2
---------------------------------------------------------------------------
254- 271 (24.61/22.68) GVMLIRElwDNFSIPGAS
278- 293 (29.53/18.35) GLGLERR..EYFGKGGAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.92| 14| 16| 87| 102| 3
---------------------------------------------------------------------------
87- 102 (17.86/15.37) PrPEVdPLDPAEMEKQ
106- 119 (26.05/12.17) P.PSV.PIPATGVSTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.00| 26| 79| 47| 74| 4
---------------------------------------------------------------------------
47- 74 (45.42/31.95) RDTASclPAANFPHN...KVPTPR.YMHFLSL
127- 156 (39.58/21.26) KDSNS..PSQNEAHTttiKTFDPQsYLSFFSM
---------------------------------------------------------------------------
|