<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27005
Description |
RNA polymerase II transcription subunit 21 mediator |
Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSPAIPPPNVPTAIPQLKKIPKNAPPNTPAAQPASGQAQGQNQKEQTPQQQQQQGGEASGGAQEQNKDLPPRPDSPNTFAQRQRELARDLIIKEQQIEYLISVLPGIGSSEAEQEARIRQLADELREAERIRRRKRKQMKKLAERVDGLLEAVSRGI |
Length | 188 |
Position | Middle |
Organism | Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) (Horse ringworm fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.859 |
Instability index | 62.71 |
Isoelectric point | 8.56 |
Molecular weight | 20949.39 |
Publications | PubMed=22951933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27005
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.83| 18| 18| 54| 71| 1
---------------------------------------------------------------------------
54- 71 (34.16/13.40) NAPPNTPAAQPA.SGQAQG
73- 91 (26.67/ 9.21) NQKEQTPQQQQQqGGEASG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.65| 19| 19| 135| 153| 2
---------------------------------------------------------------------------
100- 118 (33.18/20.54) LPPRPDSPNTFAQRQRELA
135- 153 (31.47/19.11) LPGIGSSEAEQEARIRQLA
---------------------------------------------------------------------------
|