| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDQPPS |
| Length | 135 |
| Position | Middle |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.601 |
| Instability index | 40.58 |
| Isoelectric point | 5.65 |
| Molecular weight | 15678.77 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats | >MDP26979 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ALAKNE 2) MAKYRSIRGED | 88 121 | 93 131 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab