<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26974

Description Mediator of RNA polymerase II transcription subunit 1
SequenceMKAQGETEVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAVMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYASPSDLLDDKTTSPIILHENNVPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYVPLYELITQFELSKDPDPVPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEMCSGSNKTKKKKSSRLPPDKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDPDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFPDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGESKFKSNSQADTVDFSIIAVAGKALGPADLMEHHSGSQSPLLTTGDLGKEKTQKRVKEGNGTSNSSLSGPGLDSKPGKRSRTPSNDGKNKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSASNSGKMKSSKSEGSSSSKLSSSIYSSQGSSGSSQSKTSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSTGMKSSSGLGSSGSLSQKNPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGSEDSMDGQVGVSTNSSSHPMSSKHSMSGGEFQGKREKSDKDKSKVSTSGGSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDRDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSTDRPSRLSPDFMIGEEDDDLMDVALIGN
Length1517
PositionMiddle
OrganismSus scrofa (Pig)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
Aromaticity0.04
Grand average of hydropathy-0.690
Instability index53.66
Isoelectric point8.74
Molecular weight161177.67
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	ISS:UniProtKB
nucleolus	GO:0005730	ISS:UniProtKB
nucleoplasm	GO:0005654	IEA:Ensembl
nucleus	GO:0005634	ISS:UniProtKB

GO - Biological Function
chromatin binding	GO:0003682	ISS:UniProtKB
DNA binding	GO:0003677	IEA:Ensembl
estrogen receptor binding	GO:0030331	IEA:Ensembl
LBD domain binding	GO:0050693	IEA:Ensembl
nuclear receptor coactivator activity	GO:0030374	ISS:UniProtKB
peroxisome proliferator activated receptor binding	GO:0042975	IEA:Ensembl
promoter-specific chromatin binding	GO:1990841	IEA:Ensembl
protein-containing complex binding	GO:0044877	IEA:Ensembl
retinoic acid receptor binding	GO:0042974	IEA:Ensembl
thyroid hormone receptor binding	GO:0046966	ISS:UniProtKB
transcription coactivator activity	GO:0003713	ISS:UniProtKB
transcription coregulator activity	GO:0003712	ISS:UniProtKB
transcription corepressor activity	GO:0003714	ISS:UniProtKB
vitamin D receptor binding	GO:0042809	IEA:Ensembl

GO - Biological Process
androgen biosynthetic process	GO:0006702	ISS:UniProtKB
angiogenesis	GO:0001525	ISS:UniProtKB
animal organ regeneration	GO:0031100	IEA:Ensembl
brain development	GO:0007420	IEA:Ensembl
cell morphogenesis	GO:0000902	ISS:UniProtKB
cellular response to epidermal growth factor stimulus	GO:0071364	ISS:UniProtKB
cellular response to hepatocyte growth factor stimulus	GO:0035729	IEA:Ensembl
cellular response to thyroid hormone stimulus	GO:0097067	IEA:Ensembl
embryonic heart tube development	GO:0035050	IEA:Ensembl
embryonic hemopoiesis	GO:0035162	IEA:Ensembl
embryonic hindlimb morphogenesis	GO:0035116	IEA:Ensembl
embryonic placenta development	GO:0001892	IEA:Ensembl
enucleate erythrocyte development	GO:0048822	IEA:Ensembl
epithelial cell proliferation involved in mammary gland duct elongation	GO:0060750	IEA:Ensembl
erythrocyte development	GO:0048821	ISS:UniProtKB
fat cell differentiation	GO:0045444	IEA:Ensembl
intracellular steroid hormone receptor signaling pathway	GO:0030518	ISS:UniProtKB
keratinocyte differentiation	GO:0030216	ISS:UniProtKB
lactation	GO:0007595	IEA:Ensembl
lens development in camera-type eye	GO:0002088	ISS:UniProtKB
liver development	GO:0001889	IEA:Ensembl
mammary gland branching involved in pregnancy	GO:0060745	IEA:Ensembl
mammary gland branching involved in thelarche	GO:0060744	IEA:Ensembl
megakaryocyte development	GO:0035855	ISS:UniProtKB
monocyte differentiation	GO:0030224	IEA:Ensembl
mRNA transcription by RNA polymerase II	GO:0042789	ISS:UniProtKB
negative regulation of apoptotic process	GO:0043066	ISS:UniProtKB
negative regulation of keratinocyte proliferation	GO:0010839	ISS:UniProtKB
negative regulation of neuron differentiation	GO:0045665	ISS:UniProtKB
negative regulation of transcription by RNA polymerase II	GO:0000122	ISS:UniProtKB
peroxisome proliferator activated receptor signaling pathway	GO:0035357	IEA:Ensembl
positive regulation of erythrocyte differentiation	GO:0045648	IEA:Ensembl
positive regulation of G0 to G1 transition	GO:0070318	IEA:Ensembl
positive regulation of gene expression	GO:0010628	ISS:UniProtKB
positive regulation of hepatocyte proliferation	GO:2000347	IEA:Ensembl
positive regulation of interferon-gamma-mediated signaling pathway	GO:0060335	IEA:Ensembl
positive regulation of intracellular estrogen receptor signaling pathway	GO:0033148	IEA:Ensembl
positive regulation of keratinocyte differentiation	GO:0045618	ISS:UniProtKB
positive regulation of transcription by RNA polymerase II	GO:0045944	ISS:UniProtKB
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	ISS:UniProtKB
protein import into nucleus	GO:0006606	IEA:Ensembl
regulation of RNA biosynthetic process	GO:2001141	ISS:UniProtKB
regulation of vitamin D receptor signaling pathway	GO:0070562	IEA:Ensembl
retinal pigment epithelium development	GO:0003406	IEA:Ensembl
thyroid hormone generation	GO:0006590	IEA:Ensembl
thyroid hormone mediated signaling pathway	GO:0002154	ISS:UniProtKB
ventricular trabecula myocardium morphogenesis	GO:0003222	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26974
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     387.36|      64|      64|    1039|    1102|       2
---------------------------------------------------------------------------
  537-  599 (48.08/ 8.88)	.SQ....NPI...LT..SLLQITGNGGSTIG.S...SPTP..PHHTPPP.....................vSSMAGNTKnhpMLM.NLLKDNPAQDF....ST.....LY
 1022- 1068 (68.05/15.87)	TSS....GSV...SS..SGSK.SHHS.................HS.......................SS.SSASNSGK...MKS.SKSEGSSSSKL...SSS.....IY
 1069- 1128 (85.90/22.12)	SSQ....GSS...GS..SQSKTSSQSGGKPG.S...SPIT..KHGLSSG.........................SSSTK...M....KPQGKPSSLM...NPSlskpnIS
 1129- 1185 (43.62/ 7.32)	PSHsrppGGS...DK..LASPMKPVPGTPPS.SkakSPI.......SSG...............sggSHM.SGTSSSTG...MKS.S.......SGL.............
 1255- 1317 (53.02/10.61)	..P....GSE...DSmdGQVGVSTNSSSHPM.S...S.....KHSMSGG................efQGK.REKSDKDK...SKV.STSGGSVDSSK...KTS.....ES
 1318- 1400 (44.31/ 7.56)	KNV....GST...GV..AKIIISKHDGGSPSiK...AKVTlqKPGESSGeglrpqmassknygspliSGS.TPKHERGS...PSH.SKSPAYTPQNL...DSE.......
 1401- 1488 (44.38/ 7.59)	SES....GSSiaeKS..YQNSPSSDDGIRPL.P...EYST..EKHKKHK.kekkkvkdkdrdrdrdrDRD.KKKSHSIK...PESwSKSPISSDQSLsmtSNT.....IL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     261.91|      50|      50|     262|     311|       3
---------------------------------------------------------------------------
  210-  260 (34.38/18.67)	....PLiM........GSHPVdnkWTPSF.SSITSansvdlpacFFL.KFPQPIPVSRA.................F...VQKL...Q..
  262-  311 (95.00/69.22)	CTGIPL.F........ETQPT...YVPLY.ELITQ.........FELSKDPDPVPLNHNM...............RF...YAALPGQQHC
  321-  362 (35.08/19.26)	...................PD...GRSLQgTLVSK.........ITF.QHPGRVPLILNL..............iRHqvaYNTLIGS..C
  372-  427 (52.34/33.64)	SPGLLQ.F........EV.......CPLS.E..SR.........FSVSFQH...PVNDSLvcvvmdvqdsthvscKL...YKGLSDALIC
  439-  485 (45.11/27.62)	CMSIPV.TmrairrkaETIQA...DTPAL.SLIA...........ETVED....MVKKNL...............P....PASSPG....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.55|      17|      22|     815|     834|       4
---------------------------------------------------------------------------
  815-  834 (29.12/21.57)	GFGEeyfDESSQSGDNDDFK
  913-  929 (25.42/10.30)	GNGT...SNSSLSGPGLDSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     266.70|      61|     499|     692|     752|       5
---------------------------------------------------------------------------
  606-  672 (32.39/ 9.65)	..........RQ.......NSSSGsprmemcsgsnktkkkkssrlppdKPKHQTEDDFQRELFSMDVDS....QNPifDV.NMTAD.............tlD
  673-  737 (96.41/44.70)	TPHI.TPA..PS.......QCSTP...................pttypQPVPHPQPSIQRMVRLSSSDS....IGP..DVTDILSDIAEEASKLPSTSD..D
  738-  814 (78.07/34.66)	CPPIGTPV..RD.......SSSSG......hsqsalfdpdvfqtnnneNPYTDPADLIADAAGSPSSDSptnhFFP..DGVDFNPDL......LNSQSQ..S
  841-  900 (59.83/24.67)	LNTLGVPMlgGDngeskfkSNSQA........................DTVDF...SIIAV....AGKA....LGP....ADLMEHHSGSQSPLLTTGD...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     163.82|      46|     499|     490|     535|       6
---------------------------------------------------------------------------
  490-  535 (82.68/32.83)	TGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSK
  975- 1020 (81.14/32.09)	TGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.76|      20|      22|    1187|    1207|       9
---------------------------------------------------------------------------
 1187- 1207 (31.64/16.33)	SSGSlSQKNPPSSNSCTASSS
 1211- 1230 (32.12/12.67)	SSGS.SMSSSQNQHGSSKGKS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26974 with Med1 domain of Kingdom Metazoa
Unable to open file!