<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26972
| Description |
Cyclin dependent kinase 19 |
| Sequence | MGKVRNRKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPQQQNSTQTNGTAGGAGAGAGGAGAGLQHSQDSGLNQVPPNKKPRLGPSGTNSGGPVMPSDYQHSGSRLNYQSSVQGSSQSQSTLGYSSSSQQSAQYHPSHQAHRY |
| Length | 466 |
| Position | Kinase |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.685 |
| Instability index | 55.30 |
| Isoelectric point | 8.97 |
| Molecular weight | 52543.90 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26972
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.65| 16| 17| 283| 298| 1
---------------------------------------------------------------------------
283- 298 (27.33/14.27) DPTKRITSEQALQDPY
302- 317 (29.32/15.80) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.19| 28| 37| 388| 424| 2
---------------------------------------------------------------------------
342- 382 (42.41/14.97) QHQQPTAPPQqaaAPPQAPPQqqnstqtngtAGGAGAGAGG
388- 415 (53.78/39.43) QHSQDSGLNQ...VPPNKKPR..........LGPSGTNSGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 119.22| 36| 40| 151| 190| 3
---------------------------------------------------------------------------
115- 141 (31.61/14.73) .........DLKPANILVMGEGPE.....RGRVKIADMgFA
144- 183 (59.27/40.76) FNSPLKPLADLDPVVVTFWYRAPELllgaRHYTKAIDI.WA
184- 205 (28.35/11.57) IGCIFAELLTSEPI...FHCRQEDI................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.15| 14| 15| 427| 440| 7
---------------------------------------------------------------------------
427- 440 (25.83/18.22) SRLNYQSSVQGSSQ
443- 456 (25.32/17.71) STLGYSSSSQQSAQ
---------------------------------------------------------------------------
|