<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26966

Description Mediator complex subunit 25
SequenceMVLGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTESLVQKIGERGIYFSIVSPRKLPALRLLFEKAAPPAMLEPLQPPADVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAPPSGATLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRCEFPVRVGVGMPLPTHLPHRFPCFLQLRPPQPQPQGAVGASAATGQPQPQGTAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPVAKRKREREGHVFREKWERAYFFVEVKSLPTCLICKKIVSVLKEYNLRRHYESKHSKSFDQYTEQTRDAILSELKKGLKCQ
Length540
PositionUnknown
OrganismSus scrofa (Pig)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
Aromaticity0.07
Grand average of hydropathy-0.289
Instability index62.96
Isoelectric point8.93
Molecular weight57647.72
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleoplasm	GO:0005654	IEA:Ensembl
transcription regulator complex	GO:0005667	IBA:GO_Central

GO - Biological Function
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26966
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.11|      21|      22|     238|     259|       3
---------------------------------------------------------------------------
  306-  326 (32.49/ 7.48)	PV..RVGVGMPLPTHLPHRFPCF
  437-  459 (36.61/ 6.88)	PPllHPPPAQSWPAQLPPRAPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.46|      20|      22|     238|     259|       4
---------------------------------------------------------------------------
  239-  261 (30.59/11.88)	LQPKQPVPLPPAPPSGATlsAaP
  329-  348 (29.87/ 7.24)	LRPPQPQPQGAVGASAAT..G.Q
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.83|      30|     111|      39|      69|       6
---------------------------------------------------------------------------
   39-   69 (53.46/33.51)	YLLPAIEYFN.GGPPAETdFGGDYG..GTQYSLV
  151-  183 (44.38/23.00)	YLLPAVESTTySGCTTES.LVQKIGerGIYFSIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.89|      24|     202|     185|     219|       8
---------------------------------------------------------------------------
  185-  210 (40.57/29.29)	PRKLPALRLLFEKAAPPAMLEPlqPP
  384-  407 (48.32/15.01)	PGANPQLRSLLLNPPPPQTGVP..PP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.21|      25|     206|       5|      30|       9
---------------------------------------------------------------------------
    5-   30 (39.42/21.40)	SEGPaRAGGLVADVVFVIEGTANLGP
  214-  238 (46.79/22.29)	SQDP.RHMVLVRGLVLPVGGGSAPGP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26966 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GSAPGPLQPKQPVPLPPAPPSGATLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRCEFPVRVGVGMP
2) PTHLPHRFPCFLQLRPPQPQPQGAVGASAATGQPQPQGTAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPVAKRKREREG
233
316
314
469










Molecular Recognition Features






MoRF SequenceStartStop




NANANA