<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26954
Description |
Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSTPRVLPQSKETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHFEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELEEEYYSSSCGQWDGVELPLCEAFHRQDSWGSPEMTSDPSNANPEDSDHLGSQESMQRHRNGSGTSEQS |
Length | 198 |
Position | Head |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.790 |
Instability index | 69.44 |
Isoelectric point | 4.71 |
Molecular weight | 22633.78 |
Publications | PubMed=23594743
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26954
No repeats found
|