<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26951
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MASSMGGMFPGQQPPGSHPPPGPGGPGQPGLLTGTPGNRGANNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVEKEDASELKNELQRKEMLIQKHLAKIHHWQQVLEDINVQHKKPTELPQGPLAFLEQASANLPAPMKPN |
Length | 179 |
Position | Head |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.634 |
Instability index | 46.45 |
Isoelectric point | 5.36 |
Molecular weight | 19675.03 |
Publications | PubMed=23594743
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26951
No repeats found
|