<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26947
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAAASGGEKEKERPGGGGAGAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLPPDEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSNDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 271 |
| Position | Middle |
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Canidae> Canis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.673 |
| Instability index | 47.98 |
| Isoelectric point | 4.96 |
| Molecular weight | 29721.98 |
| Publications | PubMed=16341006
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26947
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.67| 27| 28| 63| 89| 1
---------------------------------------------------------------------------
38- 57 (24.35/14.23) ....LEVL..SR..ELIEMLAISRNQKL
63- 89 (46.71/33.27) ENQVLELLI.HRDGEFQELMKLALNQGK
93- 113 (21.61/11.90) EMQVLEKEVeKRDSDIQQLQK.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.32| 12| 15| 2| 13| 3
---------------------------------------------------------------------------
2- 13 (20.69/12.86) AAASGGEKEKER
19- 30 (21.63/13.75) AGAAGGNSTRER
---------------------------------------------------------------------------
|