<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26935
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSEKNASVRANGLKGLRIDAVCNPNTKDREQPGFPAPVRSYLTSFAYCHPGFSAFPVYDIATPIWVTNLFLLVQREEKQLEASLDALLSQVADLKNSLGSFIYKLENEYDRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTSGLQQVQMAGAPSQQQPLLSGVQMAQAGQTGKMPSGIKTNIKSASMHPYQR |
Length | 234 |
Position | Head |
Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Canidae> Canis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.313 |
Instability index | 43.27 |
Isoelectric point | 8.51 |
Molecular weight | 26047.49 |
Publications | PubMed=16341006
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central
transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26935
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.53| 16| 17| 178| 194| 1
---------------------------------------------------------------------------
178- 194 (25.37/18.93) PDHlRTSGLQQVQMAGA
195- 210 (29.17/17.23) PSQ.QQPLLSGVQMAQA
---------------------------------------------------------------------------
|