<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26930

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMGASAQVSQNSITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPNSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSSQSEEQQYLEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVISSRKRKYEEDDRQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIKNPRQYAANPFLQSVYQYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA
Length372
PositionTail
OrganismGallus gallus (Chicken)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae> Phasianinae> Gallus.
Aromaticity0.05
Grand average of hydropathy-0.611
Instability index86.77
Isoelectric point9.35
Molecular weight40799.22
Publications
PubMed=15592404

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
nucleoplasm	GO:0005654	IEA:Ensembl
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP26930
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.19|      28|      28|      34|      61|       1
---------------------------------------------------------------------------
   34-   61 (59.29/20.61)	PQPQPSPQPGQPNS..QPNSNVSSGPAPSP
   64-   82 (37.72/10.43)	FLPSPSPQPSQ.....SP......AAARTP
   88-  111 (30.17/ 6.86)	PSPGPLNTPGNPNSvmSPASSSQS......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.91|      23|      28|     147|     173|       2
---------------------------------------------------------------------------
  138-  165 (35.21/17.90)	DKNEdrkkdLSKMKSLLDILTDPSKRCP
  170-  194 (39.70/13.69)	QKCE...iaLEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.62|      18|      22|     266|     283|       3
---------------------------------------------------------------------------
  266-  283 (32.82/18.05)	VARLNPKFLVNLDPSHCS
  291-  308 (32.81/18.04)	ICKLDDKNLPNVPPLQLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.57|      14|      23|     204|     217|       4
---------------------------------------------------------------------------
  204-  217 (23.65/13.74)	PLLDAVLA.NIRSPV
  228-  242 (21.91/12.26)	PAMTAIHGpPITAPV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26930 with Med15 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MPVTLTPQQLKAMQVRAQLVQQQHAAAAAVQAAQAQAAQMGASAQVSQNSITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPNSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSSQSEEQQYLEKLKQLS
1
163

Molecular Recognition Features

MoRF SequenceStartStop
NANANA