<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26930
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MGASAQVSQNSITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPNSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSSQSEEQQYLEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVISSRKRKYEEDDRQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIKNPRQYAANPFLQSVYQYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA |
| Length | 372 |
| Position | Tail |
| Organism | Gallus gallus (Chicken) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.611 |
| Instability index | 86.77 |
| Isoelectric point | 9.35 |
| Molecular weight | 40799.22 |
| Publications | PubMed=15592404
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26930
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 127.19| 28| 28| 34| 61| 1
---------------------------------------------------------------------------
34- 61 (59.29/20.61) PQPQPSPQPGQPNS..QPNSNVSSGPAPSP
64- 82 (37.72/10.43) FLPSPSPQPSQ.....SP......AAARTP
88- 111 (30.17/ 6.86) PSPGPLNTPGNPNSvmSPASSSQS......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.91| 23| 28| 147| 173| 2
---------------------------------------------------------------------------
138- 165 (35.21/17.90) DKNEdrkkdLSKMKSLLDILTDPSKRCP
170- 194 (39.70/13.69) QKCE...iaLEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.62| 18| 22| 266| 283| 3
---------------------------------------------------------------------------
266- 283 (32.82/18.05) VARLNPKFLVNLDPSHCS
291- 308 (32.81/18.04) ICKLDDKNLPNVPPLQLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.57| 14| 23| 204| 217| 4
---------------------------------------------------------------------------
204- 217 (23.65/13.74) PLLDAVLA.NIRSPV
228- 242 (21.91/12.26) PAMTAIHGpPITAPV
---------------------------------------------------------------------------
|