<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26924

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMENFSALFGGAEPPPATAAAALGFGPAKAAGTGAAPPPAAAVPPPGEDAARKAAAGPFYLLRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR
Length237
PositionHead
OrganismGallus gallus (Chicken)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae> Phasianinae> Gallus.
Aromaticity0.05
Grand average of hydropathy-0.881
Instability index64.16
Isoelectric point9.83
Molecular weight25510.87
Publications
PubMed=15592404

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364151
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP26924
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      67.93|      16|      17|     183|     198|       1
---------------------------------------------------------------------------
  165-  186 (22.50/ 9.27)	KKKNKHKHKQSRtqdpvpPETP
  187-  205 (20.63/ 7.95)	SDSDHKKKKKKK...eedPERK
  206-  223 (24.80/10.90)	RKKKEKKKKKNR....hsPEHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.51|      17|      21|      27|      46|       3
---------------------------------------------------------------------------
   27-   46 (26.71/18.31)	AKAAgtgAAPPPAAAVPPPG
   50-   66 (30.79/13.58)	ARKA...AAGPFYLLRELPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      65.29|      14|      30|      99|     113|       4
---------------------------------------------------------------------------
   99-  113 (22.67/17.50)	SNFLPDLPGMIdLPG
  121-  131 (18.82/ 8.83)	RSLIEKPP....ICG
  132-  144 (23.80/13.04)	SSFTP.LTGTM.LTG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26924 with Med19 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GSSFTRPRAYPSSAEPTQPRAPRGGQLTGQQQQQPAVRLHCAAQRS
2) PEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKK
243
153
288
214










Molecular Recognition Features






MoRF SequenceStartStop




1) AAALGFGPAKAA
19
30