<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26924
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFSALFGGAEPPPATAAAALGFGPAKAAGTGAAPPPAAAVPPPGEDAARKAAAGPFYLLRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
| Length | 237 |
| Position | Head |
| Organism | Gallus gallus (Chicken) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Phasianinae> Gallus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.881 |
| Instability index | 64.16 |
| Isoelectric point | 9.83 |
| Molecular weight | 25510.87 |
| Publications | PubMed=15592404
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26924
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.93| 16| 17| 183| 198| 1
---------------------------------------------------------------------------
165- 186 (22.50/ 9.27) KKKNKHKHKQSRtqdpvpPETP
187- 205 (20.63/ 7.95) SDSDHKKKKKKK...eedPERK
206- 223 (24.80/10.90) RKKKEKKKKKNR....hsPEHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.51| 17| 21| 27| 46| 3
---------------------------------------------------------------------------
27- 46 (26.71/18.31) AKAAgtgAAPPPAAAVPPPG
50- 66 (30.79/13.58) ARKA...AAGPFYLLRELPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.29| 14| 30| 99| 113| 4
---------------------------------------------------------------------------
99- 113 (22.67/17.50) SNFLPDLPGMIdLPG
121- 131 (18.82/ 8.83) RSLIEKPP....ICG
132- 144 (23.80/13.04) SSFTP.LTGTM.LTG
---------------------------------------------------------------------------
|