<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26920

Description Mediator of RNA polymerase II transcription subunit 25
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTETLVQKIGERGIYFSIVSPRKLPALRLLFEKAAPPAMLEPLQPPADVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAAPAGATLSTAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQATPGVGPPYSQTQATQLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLDSLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLLFFRPPQPQPQGTVGASAAAGQPQPQGAAPAPPGAPQGPPGAAPGPPPPGPSSGPSPGANPQLRILLLNPPPVRFGEGXSQGSRCSPPGSPPLCPLGLLGKSQPCLGPPEAEPPGPQGLPGDAVPSHCPPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI
Length743
PositionUnknown
OrganismBos taurus (Bovine)
KingdomMetazoa
Lineage
Aromaticity0.06
Grand average of hydropathy-0.222
Instability index57.58
Isoelectric point8.14
Molecular weight77311.81
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26920
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.16|      20|      20|     666|     685|       2
---------------------------------------------------------------------------
  667-  686 (37.59/ 7.51)	SPPGSPPLCPLGLLGKSQP..C
  688-  709 (35.57/ 6.71)	GPPEAEPPGPQGLPGDAVPshC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      99.92|      18|      21|     229|     246|       3
---------------------------------------------------------------------------
  229-  246 (38.92/11.20)	PVGGGSAPGPLQPKQPVP
  252-  269 (29.18/ 6.17)	PAGATLSTAPQQPLPPVP
  614-  629 (31.82/ 7.53)	P.GAPQGPPGAAPGPP.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.89|      19|      24|     458|     476|       5
---------------------------------------------------------------------------
  458-  476 (35.90/24.99)	LTTLGPLFR...N..SRMVQFHFT
  480-  503 (26.99/16.92)	LDSLKGLYRimgNgfAGCVHFPHT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.22|      23|     110|      39|      69|       7
---------------------------------------------------------------------------
   39-   62 (41.28/16.23)	YLLPAIEYFN.GGPPAETdFGGDYG
  151-  174 (34.94/ 9.05)	YLLPAVESTTySGCTTET.LVQKIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.72|      25|      62|     565|     593|       8
---------------------------------------------------------------------------
  189-  212 (39.62/ 8.41)	PALRLLFEKAAPPAMLE.....P.LQP.PAD
  577-  606 (38.28/13.58)	PSQNLLFFRPPQPQPQGtvgasAAAGQ.PQP
  713-  735 (32.82/ 7.00)	..QMLLSGGPRGPVPQ......PGLQPsVME
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26920 with Med25 domain of Kingdom Metazoa
Unable to open file!